Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O15552-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
7-30 (24) SSLILMAYIIIFLTGLPANLLALR PA
0
38-65 (28) QPQPAPVHILLLSLTLADLLLLLLLPFK PA
0
66-74 (9) IIEAASNFR PA
0
80-107 (28) VVCALTSFGFYSSIYCSTWLLAGISIER PA
0
108-118 (11) YLGVAFPVQYK PA
0
122-157 (36) RPLYGVIAALVAWVMSFGHCTIVIIVQYLNTTEQVR PA
0
158-180 (23) SGNEITCYENFTDNQLDVVLPVR PA
0
181-201 (21) LELCLVLFFIPMAVTIFCYWR PA
0
202-216 (15) FVWIMLSQPLVGAQR PA
0
220-249 (30) AVGLAVVTLLNFLVCFGPYNVSHLVGYHQR PA
0
256-281 (26) SIAVVFSSLNASLDPLLFYFSSSVVR PA
0
293-301 (9) NQGSSLLGR PA
0
305-314 (10) DTAEGTNEDR PA
0
315-330 (16) GVGQGEGMPSSDFTTE PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center