Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O15554-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-13 (13) MGGDLVLGLGALR PA
0
24-62 (39) SLAGWALVLAGTGIGLMVLHAEMLWFGGCSWALYLFLVK PA
0
63-82 (20) CTISISTFLLLCLIVAFHAK PA
0
83-94 (12) EVQLFMTDNGLR PA
0
104-123 (20) QAAQIVLELVVCGLHPAPVR PA
0
124-159 (36) GPPCVQDLGAPLTSPQPWPGFLGQGEALLSLAMLLR PA
0
171-180 (10) SGVLLNASYR PA
0
181-189 (9) SIGALNQVR PA
0
198-206 (9) LYMNTHPGR PA
0
207-228 (22) LLLGLTLGLWLTTAWVLSVAER PA
0
229-264 (36) QAVNATGHLSDTLWLIPITFLTIGYGDVVPGTMWGK PA
0
265-287 (23) IVCLCTGVMGVCCTALLVAVVAR PA
0
297-309 (13) HVHNFMMDIQYTK PA
0
318-327 (10) VLQEAWMFYK PA
0
344-352 (9) LLAAINAFR PA
0
363-373 (11) EQVNSMVDISK PA
0
374-390 (17) MHMILYDLQQNLSSSHR PA
0
395-402 (8) QIDTLAGK PA
0
403-417 (15) LDALTELLSTALGPR PA
0
418-427 (10) QLPEPSQQSK PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center