Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O43237-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-8 (8) MAPVGVEK PA
1
10-46 (37) LLLGPNGPAVAAAGDLTSEEEEGQSLWSSILSEVSTR PA
1
56-67 (12) NILVFGEDGSGK PA
1
74-81 (8) LQGAEHGK PA
1
85-98 (14) GLEYLYLSVHDEDR PA
1
104-116 (13) CNVWILDGDLYHK PA
1
121-151 (31) FAVSAESLPETLVIFVADMSRPWTVMESLQK PA
0
180-197 (18) DFQDYMEPEEGCQGSPQR PA
1
199-233 (35) GPLTSGSDEENVALPLGDNVLTHNLGIPVLVVCTK PA
1
234-242 (9) CDAVSVLEK PA
1
248-259 (12) DEHLDFIQSHLR PA
1
261-275 (15) FCLQYGAALIYTSVK PA
2
291-305 (15) TYGFHFTTPALVVEK PA
1
306-318 (13) DAVFIPAGWDNEK PA
1
320-346 (27) IAILHENFTTVKPEDAYEDFIVKPPVR PA
1
353-365 (13) ELAAEDEQVFLMK PA
1
398-413 (16) GGPASVPSSSPGTSVK PA
1
421-439 (19) NNAASEGVLASFFNSLLSK PA
1
441-457 (17) TGSPGSPGAGGVQSTAK PA
1
463-474 (12) TVLSNVQEELDR PA
1
478-492 (15) KPDSMVTNSSTENEA PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center