Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O43281-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-11 (11) MAIATSTQLAR PA
0
12-27 (16) ALYDNTAESPQELSFR PA
0
38-62 (25) EGAGGLDGWCLCSLHGQQGIVPANR PA
0
65-129 (65) LLPAGPAPKPSLSPASPAQPGSPYPAPDHSNEDQEVYVVPPPARPCPTSGPPAGPCPPSPDLIYK PA
0
133-142 (10) ASGTQLAAPR PA
2
143-156 (14) DALEVYDVPPTALR PA
2
157-175 (19) VPSSGPYDCPASFSHPLTR PA
2
176-210 (35) VAPQPPGEDDAPYDVPLTPKPPAELEPDLEWEGGR PA
1
211-224 (14) EPGPPIYAAPSNLK PA
1
226-286 (61) ASALLNLYEAPEELLADGEGGGTDEGIYDVPLLGPEAPPSPEPPGALASHDQDTLAQLLAR PA
1
287-295 (9) SPPPPHRPR PA
2
296-304 (9) LPSAESLSR PA
2
305-328 (24) RPLPALPVPEAPSPSPVPSPAPGR PA
2
330-343 (14) GSIQDRPLPPPPPR PA
2
344-351 (8) LPGYGGPK PA
2
352-359 (8) VEGDPEGR PA
2
360-387 (28) EMEDDPAGHHNEYEGIPMAEEYDYVHLK PA
2
392-411 (20) AQGSRPPDQACTGDPELPER PA
2
412-468 (57) GMPAPQEALSPGEPLVVSTGDLQLLYFYAGQCQSHYSALQAAVAALMSSTQANQPPR PA
2
484-493 (10) LVFVGDTLGR PA
2
494-501 (8) LAASAPLR PA
2
506-516 (11) AAGTALGQALR PA
2
524-561 (38) GAALGYPSSPAIQEMVQCVTELAGQALQFTTLLTSLAP PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2020 (C) Yonsei Proteome Research Center