Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O43281-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-36 (36) MAIATSVYVVPPPARPCPTSGPPAGPCPPSPDLIYK PA
1
40-49 (10) ASGTQLAAPR PA
2
50-63 (14) DALEVYDVPPTALR PA
2
64-82 (19) VPSSGPYDCPASFSHPLTR PA
2
83-117 (35) VAPQPPGEDDAPYDVPLTPKPPAELEPDLEWEGGR PA
1
118-131 (14) EPGPPIYAAPSNLK PA
1
133-193 (61) ASALLNLYEAPEELLADGEGGGTDEGIYDVPLLGPEAPPSPEPPGALASHDQDTLAQLLAR PA
1
194-202 (9) SPPPPHRPR PA
2
203-211 (9) LPSAESLSR PA
2
212-235 (24) RPLPALPVPEAPSPSPVPSPAPGR PA
2
237-250 (14) GSIQDRPLPPPPPR PA
2
251-258 (8) LPGYGGPK PA
2
259-266 (8) VEGDPEGR PA
2
267-294 (28) EMEDDPAGHHNEYEGIPMAEEYDYVHLK PA
2
299-318 (20) AQGSRPPDQACTGDPELPER PA
2
319-375 (57) GMPAPQEALSPGEPLVVSTGDLQLLYFYAGQCQSHYSALQAAVAALMSSTQANQPPR PA
2
391-400 (10) LVFVGDTLGR PA
2
401-408 (8) LAASAPLR PA
2
413-423 (11) AAGTALGQALR PA
2
431-468 (38) GAALGYPSSPAIQEMVQCVTELAGQALQFTTLLTSLAP PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2020 (C) Yonsei Proteome Research Center