Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O43281-3)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-36 (36) MAIATSVYVVPPPARPCPTSGPPAGPCPPSPDLIYK PA
1
40-49 (10) ASGTQLAAPR PA
2
50-63 (14) DALEVYDVPPTALR PA
2
64-82 (19) VPSSGPYDCPASFSHPLTR PA
2
83-117 (35) VAPQPPGEDDAPPSPEPPGALASHDQDTLAQLLAR PA
0
118-126 (9) SPPPPHRPR PA
2
127-135 (9) LPSAESLSR PA
2
136-159 (24) RPLPALPVPEAPSPSPVPSPAPGR PA
2
161-174 (14) GSIQDRPLPPPPPR PA
2
175-182 (8) LPGYGGPK PA
2
183-190 (8) VEGDPEGR PA
2
191-218 (28) EMEDDPAGHHNEYEGIPMAEEYDYVHLK PA
2
223-242 (20) AQGSRPPDQACTGDPELPER PA
2
243-299 (57) GMPAPQEALSPGEPLVVSTGDLQLLYFYAGQCQSHYSALQAAVAALMSSTQANQPPR PA
2
315-324 (10) LVFVGDTLGR PA
2
325-332 (8) LAASAPLR PA
2
337-347 (11) AAGTALGQALR PA
2
355-392 (38) GAALGYPSSPAIQEMVQCVTELAGQALQFTTLLTSLAP PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2020 (C) Yonsei Proteome Research Center