Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O43293-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
6-28 (23) QEDVEDHYEMGEELGSGQFAIVR PA
1
73-86 (14) HPNIITLHDIFENK PA
1
87-108 (22) TDVVLILELVSGGELFDFLAEK PA
1
109-121 (13) ESLTEDEATQFLK PA
1
122-133 (12) QILDGVHYLHSK PA
1
135-150 (16) IAHFDLKPENIMLLDK PA
3
159-167 (9) LIDFGIAHK PA
1
168-175 (8) IEAGNEFK PA
1
176-222 (47) NIFGTPEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGETK PA
1
223-249 (27) QETLTNISAVNYDFDEEYFSNTSELAK PA
1
264-276 (13) MTIAQSLEHSWIK PA
1
309-324 (16) SHSSLPPNNSYADFER PA
0
328-340 (13) VLEEAAAAEEGLR PA
0
348-363 (16) LCHEDVEALAAIYEEK PA
0
369-379 (11) EESDSLGQDLR PA
0
401-410 (10) GALLGTSGLK PA
0
446-454 (9) LQGVECGLR PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center