Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O43299-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-14 (14) MFSAGAESLLHQAR PA
1
15-22 (8) EIQDEELK PA
1
31-47 (17) LLQAEDLGPDTLDSLQR PA
1
48-56 (9) LFLIISATK PA
1
64-91 (28) TCVDLLQATLGLPACPEQLQVLCAAILR PA
1
92-110 (19) EMSPSDSLSLAWDHTQNSR PA
1
111-125 (15) QLSLVASVLLAQGDR PA
1
131-138 (8) AVGQGVLR PA
1
144-151 (8) QPEGPSLR PA
1
152-159 (8) HLLPVMAK PA
1
160-178 (19) VVVLSPGTLQEDQATLLSK PA
2
186-204 (19) YASLQQGLPHSGGFFSTPR PA
2
207-231 (25) QPGPVTEVDGAVATDFFTVLSSGHR PA
2
232-247 (16) FTDDQWLNVQAFSMLR PA
2
248-266 (19) AWLLHSGPEGPGTLDTDDR PA
2
267-285 (19) SEQEGSTLSVISATSSAGR PA
2
295-303 (9) EVAFEYCQR PA
2
323-337 (15) ACLVEAVLVLDVLCR PA
2
338-345 (8) QDPSFLYR PA
2
366-395 (30) VLLPLAHFFLSHGEAAAVDSEAVYQHLFTR PA
2
396-415 (20) IPVEQFHSPMLAFEFIQFCR PA
2
416-429 (14) DNLHLFSGHLSTLR PA
2
430-437 (8) LSFPNLFK PA
2
438-485 (48) FLAWNSPPLTSEFVALLPALVDAGTALEMLHALLDLPCLTAVLDLQLR PA
2
486-501 (16) SAPAASERPLWDTSLR PA
2
502-510 (9) APSCLEAFR PA
2
511-525 (15) DPQFQGLFQYLLRPK PA
2
533-548 (16) LAPLHQLLQPMAGCAR PA
2
549-586 (38) VAQCAQAVPTLLQAFFSAVTQVADGSLINQLALLLLGR PA
2
587-624 (38) SDSLYPAPGYAAGVHSVLSSQFLALCTLKPSLVVELAR PA
0
625-639 (15) DLLEFLGSVNGLCSR PA
0
640-660 (21) ASLVTSVVWAIGEYLSVTYDR PA
0
662-669 (8) CTVEQINK PA
0
670-692 (23) FFEALEALLFEVTQCRPSAALPR PA
0
693-707 (15) CPPQVVTVLMTTLTK PA
0
728-748 (21) TLAHSPATSSTHSEEGAEAIR PA
0
751-759 (9) ATELLTLLK PA
0
760-778 (19) MPSVAQFVLTPSTEVCSPR PA
0
782-792 (11) DANTALPLALR PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center