Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O43299-3)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
4-22 (19) VVVLSPGTLQEDQATLLSK PA
2
30-48 (19) YASLQQGLPHSGGFFSTPR PA
2
51-75 (25) QPGPVTEVDGAVATDFFTVLSSGHR PA
2
76-91 (16) FTDDQWLNVQAFSMLR PA
2
92-110 (19) AWLLHSGPEGPGTLDTDDR PA
2
111-129 (19) SEQEGSTLSVISATSSAGR PA
2
139-147 (9) EVAFEYCQR PA
2
167-181 (15) ACLVEAVLVLDVLCR PA
2
182-189 (8) QDPSFLYR PA
2
210-239 (30) VLLPLAHFFLSHGEAAAVDSEAVYQHLFTR PA
2
240-259 (20) IPVEQFHSPMLAFEFIQFCR PA
2
260-273 (14) DNLHLFSGHLSTLR PA
2
274-281 (8) LSFPNLFK PA
2
282-329 (48) FLAWNSPPLTSEFVALLPALVDAGTALEMLHALLDLPCLTAVLDLQLR PA
2
330-345 (16) SAPAASERPLWDTSLR PA
2
346-354 (9) APSCLEAFR PA
2
355-369 (15) DPQFQGLFQYLLRPK PA
2
377-392 (16) LAPLHQLLQPMAGCAR PA
2
393-430 (38) VAQCAQAVPTLLQAFFSAVTQVADGSLINQLALLLLGR PA
2
431-446 (16) SDSLYPAPGYAAGVHR PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center