Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O43303-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
15-37 (23) IQEASLSTESFLPAQSESISLIR PA
1
38-52 (15) FHGVAILSPLLNIEK PA
1
82-92 (11) VQEILDNVQVR PA
1
94-115 (22) APNASDFDQWEMETVYSNSEVR PA
1
116-138 (23) NLNVPATFPNSFPSHTEHSTAAK PA
1
142-155 (14) IAGILPLDNEDQCK PA
1
156-163 (8) TDGIDLAR PA
1
164-172 (9) DSEGFNSPK PA
1
173-189 (17) QCDSSNISHVENEAFPK PA
1
190-233 (44) TSSATPQETLISDGPFSVNEQQDLPLLAEVIPDPYVMSLQNLMK PA
1
255-263 (9) IVNESHLDK PA
1
264-275 (12) EHDAVEVADCVK PA
1
284-297 (14) HCVSVIPDKPSLNK PA
1
298-322 (25) SNVLLQGASTQASSMSMPVLASFSK PA
1
329-342 (14) TGHPTVLESNSDFK PA
1
343-355 (13) VIPTFVTENNVIK PA
1
356-363 (8) SLTGSYAK PA
1
364-374 (11) LPSPEPSMSPK PA
1
382-402 (21) TSSACHILINNPINACELSPK PA
1
405-427 (23) EQAMDLIIQDTDENTNVPEIMPK PA
1
428-439 (12) LPTDLAGVCSSK PA
1
458-472 (15) SNQVCQSSGNHLENK PA
1
473-489 (17) VTHGLVTVEGQLTSDER PA
1
490-503 (14) GAHIMNSTCAAMPK PA
1
504-533 (30) LHEPYASSQCIASPNFGTVSGLKPASMLEK PA
1
534-543 (10) NCSLQTELNK PA
1
549-561 (13) NPSPLLMQNQNTR PA
1
562-583 (22) QQMDTPMVSCGNEQFLDNSFEK PA
1
588-597 (10) LDLDIDGLQK PA
1
598-613 (16) ENCPYVITSGITEQER PA
1
649-656 (8) MLAFEEMR PA
1
659-676 (18) LEEQHAQQLSLLIAEQER PA
1
697-716 (20) AMTAEASELDINNAVELEWR PA
1
718-773 (56) ISDSSLLETMLSQADSLHTSNSNSSGFTNSAMQYSFVSANEAPFYLWGSSTSGLTK PA
1
774-782 (9) LSVTRPFGR PA
1
787-798 (12) WSQVFSLEIQAK PA
1
836-844 (9) SFQSEAPLK PA
1
846-858 (13) GIVSAQDASLQER PA
1
865-882 (18) AALYGIHDIFFVMDAAER PA
1
883-890 (8) MSILHHDR PA
1
909-917 (9) VALSAATQK PA
1
927-935 (9) AAEMGMPNK PA
1
948-961 (14) VLQPNQGQNAPVHR PA
1
992-1001 (10) VPVSGVYAGK PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center