Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O43313-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-20 (20) MAASEAAAAAGSAALAAGAR PA
0
21-43 (23) AVPAATTGAAAAASGPWVPPGPR PA
0
46-78 (33) GSRPRPAGATQQPAVPAPPAGELIQPSVSELSR PA
0
82-89 (8) TNILCTVR PA
0
94-107 (14) ILPNSPALNMHLVK PA
0
111-121 (11) LQDGIVNPTIR PA
0
130-140 (11) FYCCPIEGCPR PA
0
141-153 (13) GPERPFSQFSLVK PA
0
170-181 (12) CSNSYGTEWDLK PA
1
193-202 (10) CTCGCPYASR PA
1
203-211 (9) TALQSHIYR PA
1
212-221 (10) TGHEIPAEHR PA
1
230-238 (9) MENCAQNQK PA
1
243-266 (24) TIESLNNQPIPRPDTQELEASEIK PA
1
267-281 (15) LEPSFEDSCGSNTDK PA
1
282-289 (8) QTLTTPPR PA
1
306-363 (58) LPVMQFSVMPVFVPTADSSAQPVVLGVDQGSATGAVHLMPLSVGTLILGLDSEACSLK PA
1
371-390 (20) IANPIAGEPISTGVQVNFGK PA
1
391-405 (15) SPSNPLQELGNTCQK PA
1
406-467 (62) NSISSINVQTDLSYASQNFIPSAQWATADSSVSSCSQTDLSFDSQVSLPISVHTQTFLPSSK PA
1
468-491 (24) VTSSIAAQTDAFMDTCFQSGGVSR PA
1
492-553 (62) ETQTSGIESPTDDHVQMDQAGMCGDIFESVHSSYNVATGNIISNSLVAETVTHSLLPQNEPK PA
1
554-561 (8) TLNQDIEK PA
1
562-610 (49) SAPIINFSAQNSMLPSQNMTDNQTQTIDLLSDLENILSSNLPAQTLDHR PA
1
611-689 (79) SLLSDTNPGPDTQLPSGPAQNPGIDFDIEEFFSASNIQTQTEESELSTMTTEPVLESLDIETQTDFLLADTSAQSYGCR PA
1
690-725 (36) GNSNFLGLEMFDTQTQTDLNFFLDSSPHLPLGSILK PA
1
726-749 (24) HSSFSVSTDSSDTETQTEGVSTAK PA
1
750-757 (8) NIPALESK PA
1
758-823 (66) VQLNSTETQTMSSGFETLGSLFFTSNETQTAMDDFLLADLAWNTMESQFSSVETQTSAEPHTVSNF PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center