Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O43313-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
14-25 (12) CSNSYGTEWDLK PA
1
37-46 (10) CTCGCPYASR PA
1
47-55 (9) TALQSHIYR PA
1
56-65 (10) TGHEIPAEHR PA
1
74-82 (9) MENCAQNQK PA
1
87-110 (24) TIESLNNQPIPRPDTQELEASEIK PA
1
111-125 (15) LEPSFEDSCGSNTDK PA
1
126-133 (8) QTLTTPPR PA
1
150-207 (58) LPVMQFSVMPVFVPTADSSAQPVVLGVDQGSATGAVHLMPLSVGTLILGLDSEACSLK PA
1
215-234 (20) IANPIAGEPISTGVQVNFGK PA
1
235-249 (15) SPSNPLQELGNTCQK PA
1
250-311 (62) NSISSINVQTDLSYASQNFIPSAQWATADSSVSSCSQTDLSFDSQVSLPISVHTQTFLPSSK PA
1
312-335 (24) VTSSIAAQTDAFMDTCFQSGGVSR PA
1
336-397 (62) ETQTSGIESPTDDHVQMDQAGMCGDIFESVHSSYNVATGNIISNSLVAETVTHSLLPQNEPK PA
1
398-405 (8) TLNQDIEK PA
1
406-454 (49) SAPIINFSAQNSMLPSQNMTDNQTQTIDLLSDLENILSSNLPAQTLDHR PA
1
455-533 (79) SLLSDTNPGPDTQLPSGPAQNPGIDFDIEEFFSASNIQTQTEESELSTMTTEPVLESLDIETQTDFLLADTSAQSYGCR PA
1
534-569 (36) GNSNFLGLEMFDTQTQTDLNFFLDSSPHLPLGSILK PA
1
570-593 (24) HSSFSVSTDSSDTETQTEGVSTAK PA
1
594-601 (8) NIPALESK PA
1
602-667 (66) VQLNSTETQTMSSGFETLGSLFFTSNETQTAMDDFLLADLAWNTMESQFSSVETQTSAEPHTVSNF PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center