Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O43364-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
8-38 (31) EIGFINSQPSLAECLTSFPPVADTFQSSSIK PA
0
39-66 (28) TSTLSHSTLIPPPFEQTIPSLNPGSHPR PA
0
67-81 (15) HGAGGRPKPSPAGSR PA
0
82-99 (18) GSPVPAGALQPPEYPWMK PA
0
107-130 (24) TALLPAAAAAATAAATGPACLSHK PA
0
131-144 (14) ESLEIADGSGGGSR PA
0
148-160 (13) TAYTNTQLLELEK PA
1
174-185 (12) VEIAALLDLTER PA
1
206-213 (8) ENQNSEGK PA
0
223-230 (8) VEEDEEEK PA
0
231-246 (16) TLFEQALSVSGALLER PA
0
247-282 (36) EGYTFQQNALSQQQAPNGHNGDSQSFPVSPLTSNEK PA
0
286-376 (91) HFQHQSPTVPNCLSTMGQNCGAGLNNDSPEALEVPSLQDFSVFSTDSCLQLSDAVSPSLPGSLDSPVDISADSLDFFTDTLTTIDLQHLNY PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center