Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O43374-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
21-33 (13) DITGSSDPYCIVK PA
1
34-41 (8) VDNEPIIR PA
1
48-80 (33) TLCPFWGEEYQVHLPPTFHAVAFYVMDEDALSR PA
1
92-99 (8) DTIASHPK PA
1
100-123 (24) GFSGWAHLTEVDPDEEVQGEIHLR PA
1
124-131 (8) LEVWPGAR PA
1
151-159 (9) NGTSDPFVR PA
1
180-208 (29) WNETFEFELQEGAMEALCVEAWDWDLVSR PA
1
224-233 (10) VVQQEEGWFR PA
1
244-257 (14) HDEGNLGSLQLEVR PA
1
260-281 (22) DETVLPSSYYQPLVHLLCHEVK PA
1
282-303 (22) LGMQGPGQLIPLIEETTSTECR PA
1
304-312 (9) QDVATNLLK PA
1
313-321 (9) LFLGQGLAK PA
1
322-334 (13) DFLDLLFQLELSR PA
1
335-343 (9) TSETNTLFR PA
1
358-374 (17) VAGMQYLHGVLGPIINK PA
1
381-388 (8) YVELDPSK PA
1
393-417 (25) DVGCSGLHRPQTEAEVLEQSAQTLR PA
1
418-429 (12) AHLGALLSALSR PA
1
453-473 (21) FPGAQHENVPFIAVTSFLCLR PA
1
474-483 (10) FFSPAIMSPK PA
1
506-519 (14) AVQNVGNMDTPASR PA
1
522-533 (12) EAWMEPLQPTVR PA
1
560-569 (10) TLSLQAPPVK PA
1
570-577 (8) EGPLFIHR PA
1
582-590 (9) GPLMSSSFK PA
1
592-605 (14) LYFSLTTEALSFAK PA
1
630-656 (27) SFGGSHVMQVIYTDDAGRPQTAYLQCK PA
0
657-669 (13) CVNELNQWLSALR PA
1
671-688 (18) VSINNTGLLGSYHPGVFR PA
1
712-732 (21) VTLQEWNDPLDHDLEAQLIYR PA
1
733-744 (12) HLLGVEAMLWER PA
1
747-763 (17) ELSGGAEAGTVPTSPGK PA
1
764-771 (8) VPEDSLAR PA
1
781-803 (23) EAHSSSPAGSPPSEPNCLLELQT PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center