Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O43379-3)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-11 (11) MAAVGSGGYAR PA
3
18-28 (11) LPSVMAGVPAR PA
3
30-43 (14) GQSSPPPAPPICLR PA
3
48-59 (12) LSTASEETVQNR PA
3
65-99 (35) VLGITAQNSSGLTCDPGTGHVAYLAGCVVVILDPK PA
3
103-111 (9) QQHIFNTAR PA
3
113-124 (12) SLSALAFSPDGK PA
3
125-138 (14) YIVTGENGHRPAVR PA
3
146-155 (10) NQVAEMLGHK PA
3
156-168 (13) YGVACVAFSPNMK PA
3
169-187 (19) HIVSMGYQHDMVLNVWDWK PA
3
189-196 (8) DIVVASNK PA
3
201-219 (19) VIALSFSEDSSYFVTVGNR PA
3
223-233 (11) FWFLEVSTETK PA
3
234-243 (10) VTSTVPLVGR PA
3
244-262 (19) SGILGELHNNIFCGVACGR PA
3
265-284 (20) MAGSTFCVSYSGLLCQFNEK PA
3
295-318 (24) VSLSSCLCVSQELIFCGCTDGIVR PA
3
319-353 (35) IFQAHSLHYLANLPKPHYLGVDVAQGLEPSFLFHR PA
3
355-379 (25) AEAVYPDTVALTFDPIHQWLSCVYK PA
3
380-389 (10) DHSIYIWDVK PA
3
397-414 (18) VWSELFHSSYVWNVEALS PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center