Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O43379-4)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-11 (11) MAAVGSGGYAR PA
3
18-28 (11) LPSVMAGVPAR PA
3
30-43 (14) GQSSPPPAPPICLR PA
3
48-59 (12) LSTASEETVQNR PA
3
65-99 (35) VLGITAQNSSGLTCDPGTGHVAYLAGCVVVILDPK PA
3
103-111 (9) QQHIFNTAR PA
3
113-124 (12) SLSALAFSPDGK PA
3
125-138 (14) YIVTGENGHRPAVR PA
3
146-155 (10) NQVAEMLGHK PA
3
156-168 (13) YGVACVAFSPNMK PA
3
169-187 (19) HIVSMGYQHDMVLNVWDWK PA
3
189-196 (8) DIVVASNK PA
3
201-219 (19) VIALSFSEDSSYFVTVGNR PA
3
223-233 (11) FWFLEVSTETK PA
3
234-243 (10) VTSTVPLVGR PA
3
244-262 (19) SGILGELHNNIFCGVACGR PA
3
265-284 (20) MAGSTFCVSYSGLLCQFNEK PA
3
295-318 (24) VSLSSCLCVSQELIFCGCTDGIVR PA
3
319-353 (35) IFQAHSLHYLANLPKPHYLGVDVAQGLEPSFLFHR PA
3
355-379 (25) AEAVYPDTVALTFDPIHQWLSCVYK PA
3
380-389 (10) DHSIYIWDVK PA
3
397-420 (24) VWSELFHSSYVWNVEVYPEFEDQR PA
2
421-438 (18) ACLPSGSFLTCSSDNTIR PA
2
439-452 (14) FWNLDSSPDSHWQK PA
2
453-461 (9) NIFSNTLLK PA
1
462-481 (20) VVYVENDIQHLQDMSHFPDR PA
1
482-492 (11) GSENGTPMDVK PA
1
497-512 (16) VMQVSPDGQHLASGDR PA
1
518-529 (12) IHELHFMDELVK PA
1
530-557 (28) VEAHDAEVLCLEYSKPETGLTLLASASR PA
1
560-568 (9) LIHVLNVEK PA
1
569-587 (19) NYNLEQTLDDHSSSITAIK PA
1
593-603 (11) DIQMISCGADK PA
1
609-621 (13) SAQQGSDGLHFVR PA
1
629-641 (13) TTLYDMDIDITQK PA
1
642-650 (9) YVAVACQDR PA
1
654-661 (8) VYNTVNGK PA
1
668-678 (11) GSQGDEGSLLK PA
1
679-695 (17) VHVDPSGTFLATSCSDK PA
1
696-710 (15) SISVIDFYSGECIAK PA
1
711-722 (12) MFGHSEIITSMK PA
1
723-753 (31) FTYDCHHLITVSGDSCVFIWHLGPEITNCMK PA
1
754-762 (9) QHLLEIDHR PA
1
763-771 (9) QQQQHTNDK PA
1
779-813 (35) QDTYVSTPSEIHSLSPGEQTEDDLEEECEPEEMLK PA
1
818-825 (8) DSLDPDPR PA
1
840-855 (16) LLGDDDVADGLAFHAK PA
1
875-922 (48) TILDAQDLDCYFTPMKPESLENSILDSLEPQSLASLLSESESPQEAGR PA
1
923-932 (10) GHPSFLPQQK PA
1
933-960 (28) ESSEASELILYSLEAEVTVTGTDSQYCR PA
1
962-977 (16) EVEAGPGDQQGDSYLR PA
1
985-1018 (34) DQSPPEDSGESEADLECSFAAIHSPAPPPDPAPR PA
1
1019-1058 (40) FATSLPHFPGCAGPTEDELSLPEGPSVPSSSLPQTPEQEK PA
1
1062-1073 (12) HHFETLTESPCR PA
1
1074-1096 (23) ELFPAALGDVEASEAEDHFFNPR PA
0
1097-1109 (13) LSISTQFLSSLQK PA
1
1113-1120 (8) FTHTFPPR PA
1
1143-1152 (10) AGTGYASPDR PA
1
1153-1160 (8) THVLAAGK PA
1
1161-1192 (32) AEETLEAWRPPPPCLTSLASCVPASSVLPTDR PA
1
1193-1225 (33) NLPTPTSAPTPGLAQGVHAPSTCSYMEATASSR PA
1
1231-1250 (20) SISLGDSEGPIVATLAQPLR PA
1
1251-1286 (36) RPSSVGELASLGQELQAITTATTPSLDSEGQEPALR PA
1
1287-1294 (8) SWGNHEAR PA
1
1299-1338 (40) LTLSSACDGLLQPPVDTQPGVTVPAVSFPAPSPVEESALR PA
1
1339-1396 (58) LHGSAFRPSLPAPESPGLPAHPSNPQLPEARPGIPGGTASLLEPTSGALGLLQGSPAR PA
1
1397-1416 (20) WSEPWVPVEALPPSPLELSR PA
1
1424-1436 (13) LQTTFQEALDLYR PA
1
1437-1452 (16) VLVSSGQVDTGQQQAR PA
1
1453-1517 (65) TELVSTFLWIHSQLEAECLVGTSVAPAQALPSPGPPSPPTLYPLASPDLQALLEHYSELLVQAVR PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center