Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O43511-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
8-38 (31) SEPPQLPEYSCSYMVSRPVYSELAFQQQHER PA
0
67-77 (11) TLVPILEWLPK PA
0
82-134 (53) EWLLSDVISGVSTGLVATLQGMAYALLAAVPVGYGLYSAFFPILTYFIFGTSR PA
0
135-181 (47) HISVGPFPVVSLMVGSVVLSMAPDEHFLVSSSNGTVLNTTMIDTAAR PA
0
186-213 (28) VLIASALTLLVGIIQLIFGGLQIGFIVR PA
0
214-237 (24) YLADPLVGGFTTAAAFQVLVSQLK PA
0
238-245 (8) IVLNVSTK PA
0
246-286 (41) NYNGVLSIIYTLVEIFQNIGDTNLADFTAGLLTIVVCMAVK PA
0
296-321 (26) IPVPIPIEVIVTIIATAISYGANLEK PA
0
322-329 (8) NYNAGIVK PA
0
334-369 (36) GFLPPELPPVSLFSEMLAASFSIAVVAYAIAVSVGK PA
0
375-409 (35) YDYTIDGNQEFIAFGISNIFSGFFSCFVATTALSR PA
0
410-419 (10) TAVQESTGGK PA
0
420-440 (21) TQVAGIISAAIVMIAILALGK PA
0
448-459 (12) SVLAAVVIANLK PA
1
460-470 (11) GMFMQLCDIPR PA
1
477-512 (36) IDAVIWVFTCIVSIILGLDLGLLAGLIFGLLTVVLR PA
1
513-531 (19) VQFPSWNGLGSIPSTDIYK PA
1
538-546 (9) NIEEPQGVK PA
1
550-563 (14) FSSPIFYGNVDGFK PA
1
568-576 (9) STVGFDAIR PA
1
602-632 (31) NGIISDAVSTNNAFEPDEDIEDLEELDIPTK PA
1
633-647 (15) EIEIQVDWNSELPVK PA
1
653-674 (22) VPIHSLVLDCGAISFLDVVGVR PA
1
686-702 (17) IDVNVYFASLQDYVIEK PA
1
703-714 (12) LEQCGFFDDNIR PA
1
716-734 (19) DTFFLTVHDAILYLQNQVK PA
1
735-753 (19) SQEGQGSILETITLIQDCK PA
1
754-776 (23) DTLELIETELTEEELDVQDEAMR PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center