Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O43543-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
8-17 (10) AESGTELLAR PA
0
26-54 (29) EIEPNLFADEDSPVHGDILEFHGPEGTGK PA
0
55-64 (10) TEMLYHLTAR PA
0
70-91 (22) SEGGLEVEVLFIDTDYHFDMLR PA
0
92-99 (8) LVTILEHR PA
0
100-109 (10) LSQSSEEIIK PA
0
115-159 (45) FFLVYCSSSTHLLLTLYSLESMFCSHPSLCLLILDSLSAFYWIDR PA
0
160-174 (15) VNGGESVNLQESTLR PA
0
189-201 (13) LVLFATTQTIMQK PA
0
202-214 (13) ASSSSEEPSHASR PA
0
216-229 (14) LCDVDIDYRPYLCK PA
0
244-258 (15) QDDSQSSNQFSLVSR PA
0
268-280 (13) HFFIIGESGVEFC PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center