Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O43556-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
6-20 (15) WWELGDPCAWTGQGR PA
2
25-43 (19) MSPATTGTFLLTVYSIFSK PA
2
49-64 (16) NVYPSAGVLFVHVLER PA
2
69-102 (34) GEFPPYPKPGEISNDPITFNTNLMGYPDRPGWLR PA
2
107-136 (30) TPYSDGVLYGSPTAENVGKPTIIEITAYNR PA
2
144-167 (24) HNLIINIMSAEDFPLPYQAEFFIK PA
2
168-188 (21) NMNVEEMLASEVLGDFLGAVK PA
2
196-207 (12) LNAINITSALDR PA
2
211-219 (9) VPLPINDLK PA
2
220-237 (18) EGVYVMVGADVPFSSCLR PA
2
238-247 (10) EVENPQNQLR PA
2
248-260 (13) CSQEMEPVITCDK PA
2
264-272 (9) TQFYIDWCK PA
2
281-290 (10) QVSTYQEVIR PA
2
291-309 (19) GEGILPDGGEYKPPSDSLK PA
2
312-342 (31) DYYTDFLITLAVPSAVALVLFLILAYIMCCR PA
2
350-366 (17) NMQTPDIQLVHHSAIQK PA
1
379-434 (56) EIAWPLSTLPVFHPVTGEIIPPLHTDNYDSTNMPLMQTQQNLPHQTQIPQQQTTGK PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center