Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O43561-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-31 (31) MEEAILVPCVLGLLLLPILAMLMALCVHCHR PA
3
32-47 (16) LPGSYDSTSSDSLYPR PA
4
53-83 (31) RPHTVAPWPPAYPPVTSYPPLSQPDLLPIPR PA
2
84-93 (10) SPQPLGGSHR PA
2
100-159 (60) DSDGANSVASYENEEPACEDADEDEDDYHNPGYLVVLPDSTPATSTAAPSAPALSTPGIR PA
2
160-189 (30) DSAFSMESIDDYVNVPESGESAEASLDGSR PA
4
190-204 (15) EYVNVSQELHPGAAK PA
4
205-233 (29) TEPAALSSQEAEEVEEEGAPDYENLQELN PA
4
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center