Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O43586-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-8 (8) MMPQLQFK PA
1
15-28 (14) DFTAHTGYEVLLQR PA
1
64-74 (11) AGGQTEINSLR PA
1
82-99 (18) QQMENVGSSHIQLALTLR PA
1
150-160 (11) DADDAEQAFER PA
1
161-168 (8) ISANGHQK PA
1
182-189 (8) DSATEAER PA
1
193-200 (8) QSIAQLEK PA
1
203-210 (8) AEWEQEHR PA
1
211-223 (13) TTCEAFQLQEFDR PA
1
229-244 (16) NALWVHSNQLSMQCVK PA
1
245-253 (9) DDELYEEVR PA
1
254-272 (19) LTLEGCSIDADIDSFIQAK PA
1
273-283 (11) STGTEPPGEVR PA
0
284-291 (8) LADSAASR PA
0
292-301 (10) FSGLLHGSPK PA
1
302-321 (20) TTSLAASAASTETLTPTPER PA
1
322-346 (25) NEGVYTAIAVQEIQGNPASPAQEYR PA
1
347-382 (36) ALYDYTAQNPDELDLSAGDILEVILEGEDGWWTVER PA
1
387-396 (10) GFVPGSYLEK PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center