Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O43602-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
3-15 (13) TLPLHSHCTEMQR PA
0
20-65 (46) LEMLTLGSSFCSLQGEFCQAMDSFTTVSHVGMCEETDASFNVFSPK PA
0
78-92 (15) FHQNMELDFGHFDER PA
0
104-120 (17) MNGLPSPTHSAHCSFYR PA
4
123-131 (9) TLQALSNEK PA
4
148-157 (10) GIVYAVSSDR PA
4
160-170 (11) SFDALLADLTR PA
4
171-183 (13) SLSDNINLPQGVR PA
4
184-192 (9) YIYTIDGSR PA
4
194-215 (22) IGSMDELEEGESYVCSSDNFFK PA
4
222-232 (11) NVNPNWSVNVK PA
6
239-252 (14) APQSLASSNSAQAR PA
4
284-300 (17) TAHSFEQVLTDITEAIK PA
7
316-337 (22) QVTCLHDFFGDDDVFIACGPEK PA
4
340-353 (14) YAQDDFSLDENECR PA
4
357-366 (10) GNPSATAGPK PA
4
387-404 (18) SPADSANGTSSSQLSTPK PA
2
407-420 (14) QSPISTPTSPGSLR PA
4
424-441 (18) DLYLPLSLDDSDSLGDSM PA
4
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center