Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O43639-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-10 (10) MTEEVIVIAK PA
0
11-24 (14) WDYTAQQDQELDIK PA
0
29-36 (8) LWLLDDSK PA
1
48-58 (11) TGYVPSNYVER PA
0
88-108 (21) DASPTPSTDAEYPANGSGADR PA
0
109-119 (11) IYDLNIPAFVK PA
0
127-134 (8) EDELSLVK PA
0
151-183 (33) GSYNGQIGWFPSNYVLEEVDEAAAESPSFLSLR PA
0
185-195 (11) GASLSNGQGSR PA
0
196-218 (23) VLHVVQTLYPFSSVTEEELNFEK PA
0
219-236 (18) GETMEVIEKPENDPEWWK PA
0
242-249 (8) GQVGLVPK PA
0
250-279 (30) NYVVVLSDGPALHPAHAPQISYTGPSSSGR PA
0
284-292 (9) EWYYGNVTR PA
0
293-302 (10) HQAECALNER PA
0
303-311 (9) GVEGDFLIR PA
0
312-325 (14) DSESSPSDFSVSLK PA
0
335-347 (13) VQLVDNVYCIGQR PA
0
349-360 (12) FHTMDELVEHYK PA
0
362-372 (11) APIFTSEHGEK PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center