Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O43739-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-21 (21) MDEDGGGEGGGVPEDLSLEER PA
1
33-40 (8) ELIDDIER PA
1
43-62 (20) YEIAEVMTEIDNLTSVEESK PA
1
84-107 (24) GIQFLIENDLLQSSPEDVAQFLYK PA
1
114-123 (10) TVIGDYLGER PA
1
130-150 (21) VLQAFVELHEFADLNLVQALR PA
1
168-175 (8) MMEAFASR PA
1
176-210 (35) YCLCNPGVFQSTDTCYVLSFAIIMLNTSLHNHNVR PA
1
224-237 (14) GINEGGDLPEELLR PA
3
250-267 (18) IPEDDGNDLTHTFFNPDR PA
6
285-302 (18) WFILTDNCLYYFEYTTDK PA
6
306-316 (11) GIIPLENLSIR PA
6
323-335 (13) KPNCFELYNPSHK PA
1
350-359 (10) VVEGNHVVYR PA
1
360-368 (9) ISAPSPEEK PA
1
382-391 (10) DPFYDMLATR PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center