Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O43747-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
53-72 (20) LLYMHMLGYPAHFGQLECLK PA
1
84-96 (13) IGYLGAMLLLDER PA
1
97-108 (12) QDVHLLMTNCIK PA
1
109-136 (28) NDLNHSTQFVQGLALCTLGCMGSSEMCR PA
1
137-144 (8) DLAGEVEK PA
1
157-166 (10) AALCAVHVIR PA
1
168-180 (13) VPELMEMFLPATK PA
1
187-204 (18) NHGVLHTSVVLLTEMCER PA
1
205-213 (9) SPDMLAHFR PA
1
225-248 (24) NLIMSGYSPEHDVSGISDPFLQVR PA
1
259-282 (24) NDDDSSEAMNDILAQVATNTETSK PA
1
283-300 (18) NVGNAILYETVLTIMDIK PA
1
307-315 (9) VLAINILGR PA
1
326-334 (9) YVALTSLLK PA
1
335-345 (11) TVQTDHNAVQR PA
1
348-355 (8) STIVDCLK PA
1
365-379 (15) AMELSFALVNGNNIR PA
1
384-397 (14) ELLYFLDSCEPEFK PA
1
398-410 (13) ADCASGIFLAAEK PA
1
417-424 (8) WHIDTIMR PA
1
425-434 (10) VLTTAGSYVR PA
1
435-458 (24) DDAVPNLIQLITNSVEMHAYTVQR PA
1
462-523 (62) AILGDYSQQPLVQVAAWCIGEYGDLLVSGQCEEEEPIQVTEDEVLDILESVLISNMSTSVTR PA
1
524-532 (9) GYALTAIMK PA
1
547-562 (16) VVSIYGSSIDVELQQR PA
1
563-571 (9) AVEYNALFK PA
1
590-712 (123) VTTNGPTEIVQTNGETEPAPLETKPPPSGPQPTSQANDLLDLLGGNDITPVIPTAPTSKPSSAGGELLDLLGDINLTGAP
AAAPAPASVPQISQPPFLLDGLSSQPLFNDIAAGIPSITAYSK PA
1
724-756 (33) SNTNPSVTVITIQASNSTELDMTDFVFQAAVPK PA
1
757-783 (27) TFQLQLLSPSSSIVPAFNTGTITQVIK PA
1
804-822 (19) GSAMQDLAEVNNFPPQSWQ PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center