Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O43747-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
53-72 (20) LLYMHMLGYPAHFGQLECLK PA
1
84-96 (13) IGYLGAMLLLDER PA
1
97-108 (12) QDVHLLMTNCIK PA
1
109-136 (28) NDLNHSTQFVQGLALCTLGCMGSSEMCR PA
1
137-144 (8) DLAGEVEK PA
1
157-166 (10) AALCAVHVIR PA
1
168-180 (13) VPELMEMFLPATK PA
1
187-204 (18) NHGVLHTSVVLLTEMCER PA
1
205-213 (9) SPDMLAHFR PA
1
228-251 (24) NLIMSGYSPEHDVSGISDPFLQVR PA
1
262-285 (24) NDDDSSEAMNDILAQVATNTETSK PA
1
286-303 (18) NVGNAILYETVLTIMDIK PA
1
310-318 (9) VLAINILGR PA
1
329-337 (9) YVALTSLLK PA
1
338-348 (11) TVQTDHNAVQR PA
1
351-358 (8) STIVDCLK PA
1
368-382 (15) AMELSFALVNGNNIR PA
1
387-400 (14) ELLYFLDSCEPEFK PA
1
401-413 (13) ADCASGIFLAAEK PA
1
420-427 (8) WHIDTIMR PA
1
428-437 (10) VLTTAGSYVR PA
1
438-461 (24) DDAVPNLIQLITNSVEMHAYTVQR PA
1
465-526 (62) AILGDYSQQPLVQVAAWCIGEYGDLLVSGQCEEEEPIQVTEDEVLDILESVLISNMSTSVTR PA
1
527-535 (9) GYALTAIMK PA
1
550-565 (16) VVSIYGSSIDVELQQR PA
1
566-574 (9) AVEYNALFK PA
1
593-715 (123) VTTNGPTEIVQTNGETEPAPLETKPPPSGPQPTSQANDLLDLLGGNDITPVIPTAPTSKPSSAGGELLDLLGDINLTGAP
AAAPAPASVPQISQPPFLLDGLSSQPLFNDIAAGIPSITAYSK PA
1
727-759 (33) SNTNPSVTVITIQASNSTELDMTDFVFQAAVPK PA
1
760-786 (27) TFQLQLLSPSSSIVPAFNTGTITQVIK PA
1
807-825 (19) GSAMQDLAEVNNFPPQSWQ PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center