Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O43761-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-10 (10) MEGASFGAGR PA
0
11-22 (12) AGAALDPVSFAR PA
0
30-58 (29) VASWVFSIAVFGPIVNEGYVNTDSGPELR PA
0
59-69 (11) CVFNGNAGACR PA
0
70-91 (22) FGVALGLGAFLACAAFLLLDVR PA
0
92-99 (8) FQQISSVR PA
0
104-132 (29) AVLLDLGFSGLWSFLWFVGFCFLTNQWQR PA
0
133-147 (15) TAPGPATTQAGDAAR PA
0
148-166 (19) AAIAFSFFSILSWVALTVK PA
0
173-222 (50) LGTDMSLFATEQLSTGASQAYPGYPVGSGVEGTETYQSPPFTETLDTSPK PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center