Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O43868-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
8-29 (22) QSIALSTVETGTVNPGLELMEK PA
0
30-37 (8) EVEPEGSK PA
0
39-57 (19) TDAQGHSLGDGLGPSTYQR PA
0
80-103 (24) ILLGLLCLAYAAYLLAACILNFQR PA
0
104-124 (21) ALALFVITCLVIFVLVHSFLK PA
0
134-142 (9) CLKPFENSR PA
0
149-192 (44) WVFAGVSLVGLILWLALDTAQRPEQLIPFAGICMFILILFACSK PA
0
193-200 (8) HHSAVSWR PA
0
201-218 (18) TVFSGLGLQFVFGILVIR PA
0
219-254 (36) TDLGYTVFQWLGEQVQIFLNYTVAGSSFVFGDTLVK PA
0
255-287 (33) DVFAFQALPIIIFFGCVVSILYYLGLVQWVVQK PA
0
288-378 (91) VAWFLQITMGTTATETLAVAGNIFVGMTEAPLLIRPYLGDMTLSEIHAVMTGGFATISGTVLGAFIAFGVDASSLISASVMAAPCALASSK PA
0
379-388 (10) LAYPEVEESK PA
0
404-487 (84) NVLEAASNGAVDAIGLATNVAANLIAFLAVLAFINAALSWLGELVDIQGLTFQVICSYLLRPMVFMMGVEWTDCPMVAEMVGIK PA
0
488-503 (16) FFINEFVAYQQLSQYK PA
0
507-518 (12) LSGMEEWIEGEK PA
0
525-556 (32) AEIITTFSLCGFANLSSIGITLGGLTSIVPHR PA
0
567-589 (23) ALFTGACVSLISACMAGILYVPR PA
0
590-606 (17) GAEADCVSFPNTSFTNR PA
0
607-615 (9) TYETYMCCR PA
0
616-638 (23) GLFQSTSLNGTNPPSFSGPWEDK PA
0
639-658 (20) EFSAMALTNCCGFYNNTVCA PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center