Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O43914-3)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-9 (9) MGGLEPCSR PA
2
10-55 (46) LLLLPLLLAVSDCSCSTVSPGVLAGIVMGDLVLTVLIALAVYFLGR PA
0
62-69 (8) GAAEAATR PA
1
73-87 (15) ITETESPYQELQGQR PA
2
88-102 (15) SDVYSDLNTQRPYYK PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center