Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O43921-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-25 (25) MAPAQRPLLPLLLLLLPLPPPPFAR PA
0
48-85 (38) FHAGAGDDGGGYTVEVSINDYLDIYCPHYGAPLPPAER PA
0
86-105 (20) MEHYVLYMVNGEGHASCDHR PA
0
112-125 (14) WECNRPAAPGGPLK PA
0
130-165 (36) FQLFTPFSLGFEFRPGHEYYYISATPPNAVDRPCLR PA
0
168-198 (31) VYVRPTNETLYEAPEPIFTSNNSCSSPGGCR PA
0
199-213 (15) LFLSTIPVLWTLLGS PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center