Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O43933-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
7-25 (19) LAGAGGGGAAVTVAFTNAR PA
1
26-33 (8) DCFLHLPR PA
1
35-64 (30) LVAQLHLLQNQAIEVVWSHQPAFLSWVEGR PA
1
65-78 (14) HFSDQGENVAEINR PA
1
84-135 (52) LGLSNGGQVFLKPCSHVVSCQQVEVEPLSADDWEILELHAVSLEQHLLDQIR PA
0
141-168 (28) AIFPVWVDQQTYIFIQIVALIPAASYGR PA
0
217-259 (43) QLQSNTVGITESNENESEIPVDSSSVASLWTMIGSIFSFQSEK PA
0
261-274 (14) QETSWGLTEINAFK PA
0
280-288 (9) VVPLDNIFR PA
0
292-308 (17) SQPPSIYNASATSVFHK PA
0
309-334 (26) HCAIHVFPWDQEYFDVEPSFTVTYGK PA
0
350-357 (8) QNVLSPEK PA
0
360-368 (9) QMSEPLDQK PA
0
372-380 (9) SDHNEEDEK PA
0
381-399 (19) ACVLQVVWNGLEELNNAIK PA
0
403-411 (9) NVEVLHLGK PA
0
412-419 (8) VWIPDDLR PA
0
422-431 (10) LNIEMHAVVR PA
1
432-440 (9) ITPVEVTPK PA
1
456-463 (8) DISEEDIK PA
1
464-489 (26) TVFYSWLQQSTTTMLPLVISEEEFIK PA
1
498-509 (12) EFSLSIVHSWEK PA
1
514-525 (12) NIFLLSPNLLQK PA
1
526-537 (12) TTIQVLLDPMVK PA
1
538-552 (15) EENSEEIDFILPFLK PA
1
553-581 (29) LSSLGGVNSLGVSSLEHITHSLLGRPLSR PA
1
582-591 (10) QLMSLVAGLR PA
1
592-601 (10) NGALLLTGGK PA
1
643-687 (45) TLEVAFSEAVWMQPSVVLLDDLDLIAGLPAVPEHEHSPDAVQSQR PA
1
688-697 (10) LAHALNDMIK PA
1
698-745 (48) EFISMGSLVALIATSQSQQSLHPLLVSAQGVHIFQCVQHIQPPNQEQR PA
1
746-754 (9) CEILCNVIK PA
1
764-774 (11) FTDLDLQHVAK PA
1
775-782 (8) ETGGFVAR PA
1
783-790 (8) DFTVLVDR PA
1
807-816 (10) LVLTTLDFQK PA
1
820-827 (8) GFLPASLR PA
1
828-835 (8) SVNLHKPR PA
1
842-849 (8) IGGLHEVR PA
1
850-861 (12) QILMDTIQLPAK PA
1
862-872 (11) YPELFANLPIR PA
1
875-887 (13) TGILLYGPPGTGK PA
1
888-896 (9) TLLAGVIAR PA
1
914-923 (10) YIGASEQAVR PA
1
929-948 (20) AQAAKPCILFFDEFESIAPR PA
1
950-959 (10) GHDNTGVTDR PA
1
960-998 (39) VVNQLLTQLDGVEGLQGVYVLAATSRPDLIDPALLRPGR PA
1
1002-1013 (12) CVYCPPPDQVSR PA
1
1014-1048 (35) LEILNVLSDSLPLADDVDLQHVASVTDSFTGADLK PA
1
1049-1122 (74) ALLYNAQLEALHGMLLSSGLQDGSSSSDSDLSLSSMVFLNHSSGSDDSAGDGECGLDQSLVSLEMSEILPDESK PA
1
1128-1167 (40) LYFGSSYESELGNGTSSDLSSQCLSAPSSMTQDLPGVPGK PA
1
1168-1178 (11) DQLFSQPPVLR PA
1
1179-1193 (15) TASQEGCQELTQEQR PA
1
1209-1224 (16) SQSGEDESMNQPGPIK PA
1
1227-1251 (25) LAISQSHLMTALGHTRPSISEDDWK PA
1
1252-1264 (13) NFAELYESFQNPK PA
1
1268-1279 (12) NQSGTMFRPGQK PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center