Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O43933-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
7-25 (19) LAGAGGGGAAVTVAFTNAR PA
1
26-33 (8) DCFLHLPR PA
1
35-64 (30) LVAQLHLLQNQAIEVVWSHQPAFLSWVEGR PA
1
65-78 (14) HFSDQGENVAEINR PA
1
84-97 (14) LGLSNGGQIPDDLR PA
0
100-109 (10) LNIEMHAVVR PA
1
110-118 (9) ITPVEVTPK PA
1
134-141 (8) DISEEDIK PA
1
142-167 (26) TVFYSWLQQSTTTMLPLVISEEEFIK PA
1
176-187 (12) EFSLSIVHSWEK PA
1
192-203 (12) NIFLLSPNLLQK PA
1
204-215 (12) TTIQVLLDPMVK PA
1
216-230 (15) EENSEEIDFILPFLK PA
1
231-259 (29) LSSLGGVNSLGVSSLEHITHSLLGRPLSR PA
1
260-269 (10) QLMSLVAGLR PA
1
270-279 (10) NGALLLTGGK PA
1
321-365 (45) TLEVAFSEAVWMQPSVVLLDDLDLIAGLPAVPEHEHSPDAVQSQR PA
1
366-375 (10) LAHALNDMIK PA
1
376-423 (48) EFISMGSLVALIATSQSQQSLHPLLVSAQGVHIFQCVQHIQPPNQEQR PA
1
424-432 (9) CEILCNVIK PA
1
442-452 (11) FTDLDLQHVAK PA
1
453-460 (8) ETGGFVAR PA
1
461-468 (8) DFTVLVDR PA
1
485-494 (10) LVLTTLDFQK PA
1
498-505 (8) GFLPASLR PA
1
506-513 (8) SVNLHKPR PA
1
520-527 (8) IGGLHEVR PA
1
528-539 (12) QILMDTIQLPAK PA
1
540-550 (11) YPELFANLPIR PA
1
553-565 (13) TGILLYGPPGTGK PA
1
566-574 (9) TLLAGVIAR PA
1
592-601 (10) YIGASEQAVR PA
1
607-626 (20) AQAAKPCILFFDEFESIAPR PA
1
628-637 (10) GHDNTGVTDR PA
1
638-676 (39) VVNQLLTQLDGVEGLQGVYVLAATSRPDLIDPALLRPGR PA
1
680-691 (12) CVYCPPPDQVSR PA
1
692-726 (35) LEILNVLSDSLPLADDVDLQHVASVTDSFTGADLK PA
1
727-800 (74) ALLYNAQLEALHGMLLSSGLQDGSSSSDSDLSLSSMVFLNHSSGSDDSAGDGECGLDQSLVSLEMSEILPDESK PA
1
806-845 (40) LYFGSSYESELGNGTSSDLSSQCLSAPSSMTQDLPGVPGK PA
1
846-856 (11) DQLFSQPPVLR PA
1
857-871 (15) TASQEGCQELTQEQR PA
1
887-902 (16) SQSGEDESMNQPGPIK PA
1
905-929 (25) LAISQSHLMTALGHTRPSISEDDWK PA
1
930-942 (13) NFAELYESFQNPK PA
1
946-957 (12) NQSGTMFRPGQK PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center