Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O60268-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-70 (70) METPEVPVGSLIDFGPEAPTSSPLEAPPPVLQDGDGSLGDGASESETTESADSENDMGESPSHPSWDQDR PA
2
72-96 (25) SSSNESFSSNQSTESTQDEETLALR PA
2
106-118 (13) IFSGGEDLDQEEK PA
2
121-131 (11) FGEYCSSENGK PA
2
149-157 (9) CVSEATFYR PA
2
158-179 (22) LVQSFAVVLFECHQMDDFGPAK PA
2
180-202 (23) NLMTMCFTYYHIGKPQLLPPESR PA
2
203-214 (12) EKPAGSIDSYLK PA
2
215-223 (9) SANSWLAEK PA
2
243-251 (9) GFFGGLETK PA
2
260-270 (11) NEEDENKPQEK PA
2
274-284 (11) AVTAYSPEDEK PA
2
289-296 (8) IYLYTHLK PA
2
297-305 (9) QQPIWHTLR PA
1
306-319 (14) FWNAAFFDAVHCER PA
1
328-336 (9) GDAGEEEEK PA
0
340-348 (9) WCHMTQEER PA
1
354-377 (24) FNENITFGQLGTFTHNMLAFGLNK PA
1
387-399 (13) QAVIGNLDEEQYK PA
1
400-411 (12) LLSDHIEQMATE PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center