Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O60290-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
5-20 (16) WCEWTVLTGIEYLQQR PA
0
21-30 (10) FDADRPPQLK PA
1
31-59 (29) NMEVFDTMAWPSGIELASFGNDDILNLAR PA
1
60-82 (23) YFECSLPTGYSEEALLEEWLGLK PA
1
83-95 (13) TIAQHLPFSMLCK PA
1
96-103 (8) NALAQHCR PA
1
110-126 (17) LMAVVVCVPISTSCCER PA
1
142-179 (38) LSNEVLNMLMMTAVNGVAVTEYDPQPAIQHWYLTSSGR PA
1
181-193 (13) FSHVYTCAQVPAR PA
1
203-214 (12) EEMGALYVEEPR PA
1
215-224 (10) TQKPPILPSR PA
1
232-240 (9) DCIMEPPER PA
1
241-254 (14) LLYPHTSQEAPGMS PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center