Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O60291-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
9-24 (16) IAGVEDIDIQANSAYR PA
3
29-43 (15) SGNYFASHFFMGGEK PA
3
44-82 (39) FDTPHPEGYLFGENMDLNFLGSRPVQFPYVTPAPHEPVK PA
3
102-115 (14) DDADSPTEDGDKPR PA
3
116-129 (14) VLYSLEFTFDADAR PA
3
130-146 (17) VAITIYCQASEEFLNGR PA
3
153-164 (12) SPSLQSETVHYK PA
3
166-177 (12) GVSQQFSLPSFK PA
3
185-194 (10) DDELNFDLDR PA
3
195-226 (32) GVFPVVIQAVVDEGDVVEVTGHAHVLLAAFEK PA
3
227-238 (12) HMDGSFSVKPLK PA
3
246-259 (14) VSYLLQEIYGIENK PA
3
260-286 (27) NNQETKPSDDENSDNSNECVVCLSDLR PA
3
287-294 (8) DTLILPCR PA
5
295-307 (13) HLCLCTSCADTLR PA
3
308-317 (10) YQANNCPICR PA
5
332-359 (28) KPGALSPVSFSPVLAQSLEHDEHSCPFK PA
1
361-371 (11) SKPHPASLASK PA
1
376-399 (24) ETNSDSVPPGYEPISLLEALNGLR PA
1
400-441 (42) AVSPAIPSAPLYEEITYSGISDGLSQASCPLAAIDHILDSSR PA
3
457-469 (13) SPSSPIHEEDEEK PA
3
470-488 (19) LSEDVDAPPPLGGAELALR PA
3
489-512 (24) ESSSPESFITEEVDESSSPQQGTR PA
3
513-530 (18) AASIENVLQDSSPEHCGR PA
3
531-576 (46) GPPADIYLPGRPTSMETAHGLATTSPTWPPLGGPSPDPSAAELTPL PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center