Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O60292-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
6-21 (16) AIPSDGVDLAASCGAR PA
0
22-76 (55) VGDVLPGPHTGDYAPLGFWAQNGSMSQPLGESPATATATATATTRPSPTTPAMPK PA
0
95-109 (15) EHSNPSPSQDTDGTK PA
0
119-136 (18) SIQNGQPPTSTPASSGSK PA
0
148-157 (10) DVEFQDGWPR PA
0
170-188 (19) SSSEITLSECDAEDAGEPR PA
0
192-200 (9) HTGALPLFR PA
0
201-226 (26) EYGSTSSIDVQGMPEQSFFDILNEFR PA
0
234-243 (10) GCQALTELLR PA
0
244-258 (15) ADPGPHLMGGGGGAK PA
0
259-268 (10) GDSHNGQPAK PA
0
269-278 (10) DSLLPLQPTK PA
0
290-303 (14) GLGGGDTVDSSIFR PA
0
307-316 (10) SSKPEGEAGR PA
0
317-325 (9) SPGEADEGR PA
0
326-338 (13) SPPEASRPWVCQK PA
0
339-359 (21) SFAHFDVQSMLFDLNEAAANR PA
0
367-388 (22) NTTTGASAASAASAMASLTASR PA
0
389-408 (20) AHSLGGLDPAFTSTEDLNCK PA
0
409-431 (23) ENLEQDLGDDNSNDLLLSCPHFR PA
0
432-440 (9) NEIGGECER PA
0
447-468 (22) ASVGSPSSGEGHLAEPALSAYR PA
0
469-480 (12) TNASISVLEVPK PA
0
491-502 (12) QYSIEHVDLGAR PA
0
503-511 (9) YYQDYFVGK PA
0
512-522 (11) EHANYFGVDEK PA
0
523-531 (9) LGPVAVSIK PA
0
540-548 (9) EHGPQYQYR PA
0
561-573 (13) GSILEDATPTATK PA
0
584-599 (16) DALEYVIPELNIHCLR PA
0
614-621 (8) LDEQGLCR PA
0
632-660 (29) AGQSSEEEMYNNEEAGPAFEEFLSLIGEK PA
0
669-676 (8) YAAQLDVK PA
0
677-709 (33) TDSTGTHSLYTMYQDYEIMFHVSTLLPYTPNNR PA
0
717-738 (22) HIGNDIVTIIFQEPGALPFTPK PA
0
742-752 (11) SHFQHVFIIVR PA
0
753-769 (17) VHNPCTDNVCYSMAVTR PA
0
772-787 (16) DAPPFGPPIPSGTTFR PA
0
800-809 (10) VINAENAAHK PA
4
827-843 (17) DLAENCVSNTPIDSTGK PA
0
844-852 (9) FNLISLTSK PA
0
861-874 (14) AGAEQHSAGAIAWR PA
0
875-903 (29) VVAQDYAQGVEIDCILGISNEFVVLLDLR PA
0
906-927 (22) EVVFNCYCGDVIGWTPDSSTLK PA
0
933-949 (17) GDHIFLQATEGSVEDIR PA
0
957-970 (14) VMTSGWETVDMTLR PA
0
972-982 (11) NGLGQLGFHVK PA
0
983-1002 (20) YDGTVAEVEDYGFAWQAGLR PA
0
1013-1028 (16) VAVVTLTHDQMIDLLR PA
0
1035-1047 (13) VVIIPPFEDGTPR PA
0
1049-1062 (14) GWPETYDMNTSEPK PA
0
1063-1077 (15) TEQESITPGGRPPYR PA
0
1078-1097 (20) SNAPWQWSGPASHNSLPASK PA
0
1098-1115 (18) WATPTTPGHAQSLSRPLK PA
0
1116-1123 (8) QTPIVPFR PA
0
1124-1131 (8) ESQPLHSK PA
0
1132-1150 (19) RPVSFPETPYTVSPAGADR PA
0
1156-1171 (16) QPSGSFSTPGSATYVR PA
0
1179-1217 (39) YTAAPHPLLSLDPHFSHDGTSSGDSSSGGLTSQESTMER PA
0
1218-1231 (14) QKPEPLWHVPAQAR PA
0
1232-1242 (11) LSAIAGSSGNK PA
0
1261-1286 (26) GEPQYSSHSSSNTLSSNASSSHSDDR PA
0
1287-1303 (17) WFDPLDPLEPEQDPLSK PA
0
1304-1327 (24) GGSSDSGIDTTLYTSSPSCMSLAK PA
0
1328-1348 (21) APRPAKPHKPPGSMGLCGGGR PA
0
1362-1374 (13) EVSPAPAVAGQSK PA
0
1380-1396 (17) LYSSGSSTPTGLAGGSR PA
0
1401-1408 (8) QPSDMGSR PA
0
1409-1417 (9) VGYPAQVYK PA
0
1418-1443 (26) TASAETPRPSQLAQPSPFQLSASVPK PA
0
1462-1476 (15) TEEPPPRPLPFSDPK PA
0
1508-1515 (8) STIEDDLK PA
0
1517-1529 (13) LIIMDNLGPEQER PA
0
1530-1537 (8) DTGQSPQK PA
0
1542-1552 (11) TLSDESLCSGR PA
0
1554-1587 (34) EPSFASPAGLEPGLPSDVLFTSTCAFPSSTLPAR PA
0
1589-1612 (24) QHQHPHPPVGPGATPAAGSGFPEK PA
0
1614-1627 (14) STISASELSLADGR PA
0
1634-1658 (25) LDPGLMPLPDTAAGLEWSSLVNAAK PA
0
1665-1695 (31) AVSLFSLNDPALSPDIPPAHSPVHSHLSLER PA
0
1702-1717 (16) TTPTMSEEPPLDLTGK PA
0
1718-1726 (9) VYQLEVMLK PA
0
1727-1734 (8) QLHTDLQK PA
0
1740-1750 (11) VVLQSEVASLR PA
0
1756-1768 (13) LQEESQAASEQLR PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center