Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O60303-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
26-34 (9) DMVTDFDEK PA
0
35-45 (11) HDEYLILLQQR PA
0
62-81 (20) LEHLEQGFSVYVNGANSELK PA
0
87-94 (8) AIHSDFSR PA
0
95-107 (13) SASHTEGTHDYGR PA
0
149-183 (35) LHIEPPVDYSDDFELCGDVTLQANNTSEDRPQELR PA
0
185-194 (10) SLELSVNLQR PA
0
198-227 (30) DCSSDEYDSIEEDILSEPEPEDPALVGHPR PA
0
228-240 (13) HDRPPSSGDWTQK PA
0
241-251 (11) DVHGEQETEGR PA
0
252-269 (18) SSPGPDTLVVLEFNPASK PA
0
283-310 (28) DNAEVFVPTKPEPNLTPQAPAVFPDQER PA
0
311-318 (8) MCSRPGSR PA
0
320-327 (8) ERPLSATR PA
0
329-356 (28) TLCEAEYPEEDASAVLQAIQVENAALQR PA
0
363-388 (26) AEQPASPLQDAEGPPAKPWTSLLEEK PA
0
389-414 (26) EETLELLPITTATTTQEPAGAAGGAR PA
0
415-422 (8) AINQAMDR PA
0
437-450 (14) VLQAVESDSAHLGR PA
0
457-465 (9) EQVSDTEDK PA
0
475-507 (33) DAIYVTMEILSNWGNSWWVGLTEVEFFDLNDTK PA
0
508-518 (11) LYVSPHDVDIR PA
0
519-528 (10) NTATPGELGR PA
0
539-558 (20) DSSPWTCPFHPPLQLFFVIR PA
0
562-570 (9) QLGDFHLAK PA
0
575-588 (14) NYWTADGDLDIGAK PA
0
610-622 (13) EAPADHSILVDQK PA
0
626-641 (16) SEQLEEAMNAHSEESK PA
0
642-653 (12) GTHEMAGASGDK PA
0
654-670 (17) ELGLGCSPPAETLADAK PA
0
671-680 (10) LSSQGNVSGK PA
0
690-700 (11) DSLSQLEEYLR PA
0
701-722 (22) LSAVPTSMGDMPSAPATSPPVK PA
0
723-742 (20) CPPVHEEPSLIQQLENLMGR PA
0
751-762 (12) TPSWLQPSPTGK PA
0
770-785 (16) KPKPLWLSPEKPLAWK PA
0
788-804 (17) LPSDDVIGEGPGETEAR PA
0
810-818 (9) HEPGWGTSR PA
0
833-847 (15) VHSDDSDIFNQPPNR PA
0
860-874 (15) DAGSSSHGDDQPASR PA
0
890-908 (19) SEQEHTLHESWSSLSAFDR PA
0
914-931 (18) ISNTELPGDILDELLQQK PA
0
935-942 (8) HSDLPPSK PA
0
944-951 (8) GEQPGLSR PA
0
952-967 (16) GQDGYSGETDAGGDFK PA
0
968-976 (9) IPVLPYGQR PA
0
989-1002 (14) HYVGLNGIEIFSSK PA
0
1003-1012 (10) GEPVQISNIK PA
0
1013-1026 (14) ADPPDINILPAYGK PA
0
1030-1040 (11) VVTNLIDGVNR PA
0
1041-1054 (14) TQDDMHVWLAPFTR PA
0
1057-1074 (18) SHSITIDFTHPCHVALIR PA
0
1091-1108 (18) DITMLLDTQCIFEGEIAK PA
0
1109-1160 (52) ASGTLAGAPEHFGDTILFTTDDDILEAIFYSDEMFDLDVGSLDSLQDEEAMR PA
0
1161-1184 (24) RPSTADGEGDERPFTQAGLGADER PA
0
1185-1236 (52) IPELELPSSSPVPQVTTPEPGIYHGICLQLNFTASWGDLHYLGLTGLEVVGK PA
0
1237-1253 (17) EGQALPIHLHQISASPR PA
0
1254-1266 (13) DLNELPEYSDDSR PA
0
1271-1300 (30) LIDGTNITMEDEHMWLIPFSPGLDHVVTIR PA
0
1304-1311 (8) AESIAGLR PA
0
1328-1347 (20) IVHVSLDGLCVSPPEGFLIR PA
0
1349-1368 (20) GPGNCHFDFAQEILFVDYLR PA
0
1369-1377 (9) AQLLPQPAR PA
0
1383-1427 (45) SLECASMDYEAPLMPCGFIFQFQLLTSWGDPYYIGLTGLELYDER PA
0
1431-1456 (26) IPLSENNIAAFPDSVNSLEGVGGDVR PA
0
1461-1472 (12) LIDQVNDTSDGR PA
0
1473-1486 (14) HMWLAPILPGLVNR PA
0
1487-1501 (15) VYVIFDLPTTVSMIK PA
0
1515-1559 (45) EFGLLVDDLLVYNGILAMVSHLVGGILPTCEPTVPYHTILFTEDR PA
0
1567-1592 (26) HTTISNQAEDQDVQMMNENQIITNAK PA
0
1595-1605 (11) QSVVDPALRPK PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center