Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O60307-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-8 (8) MDESSLLR PA
0
32-63 (32) SLVVGTPSPTLSRPLSPLSVPTAGSSPLDSPR PA
0
64-77 (14) NFSAASALNFPFAR PA
0
84-110 (27) WSLASLPSSGYGTNTPSSTLSSSSSSR PA
0
113-130 (18) LHQLPFQPTPDELHFLSK PA
0
134-145 (12) SSENVLDEEGGR PA
0
161-177 (17) ATGTFDNEIVMMNHVYR PA
0
183-190 (8) ATAQMEGR PA
0
191-203 (13) LQEFLTAYAPGAR PA
0
204-223 (20) LALADGVLGFIHHQIVELAR PA
0
229-237 (9) SGENLVTSR PA
0
238-245 (8) YFLEMQEK PA
0
249-256 (8) LLQDAHER PA
1
257-270 (14) SDSEEVSFIVQLVR PA
0
272-281 (10) LLIIISRPAR PA
1
282-305 (24) LLECLEFDPEEFYHLLEAAEGHAR PA
0
312-326 (15) TDLPQYIIGQLGLAK PA
0
327-352 (26) DPLEEMVPLSHLEEEQPPAPESPESR PA
0
361-371 (11) KPCESDFETIK PA
0
372-385 (14) LISNGAYGAVYLVR PA
1
407-416 (10) NQIQQVFVER PA
0
417-437 (21) DILTFAENPFVVSMFCSFETR PA
0
439-457 (19) HLCMVMEYVEGGDCATLLK PA
3
458-468 (11) NMGPLPVDMAR PA
4
469-489 (21) LYFAETVLALEYLHNYGIVHR PA
2
490-505 (16) DLKPDNLLITSLGHIK PA
0
506-513 (8) LTDFGLSK PA
16
514-530 (17) IGLMSMATNLYEGHIEK PA
0
539-554 (16) QVCGTPEYIAPEVIFR PA
0
555-616 (62) QGYGKPVDWWAMGVVLYEFLVGCVPFFGDTPEELFGQVVSDEIMWPEGDEALPADAQDLITR PA
0
626-635 (10) LGTGGTHEVK PA
0
636-650 (15) QHPFFLALDWAGLLR PA
0
653-671 (19) AEFVPQLEAEDDTSYFDTR PA
0
677-703 (27) HLGSEDDETNDEESSTEIPQFSSCSHR PA
0
707-725 (19) VYSSSEFLAVQPTPTFAER PA
0
754-771 (18) SWTSSGSSCQSSSSQPER PA
0
772-788 (17) GPSPSLLNTISLDTMPK PA
0
789-806 (18) FAFSSEDEGVGPGPAGPK PA
0
807-842 (36) RPVFILGEPDPPPAATPVMPKPSSLSADTAALSHAR PA
0
852-862 (11) HSTPRPLDAGR PA
0
879-892 (14) ASSSGGSGGGSGGR PA
0
896-923 (28) SASVSALSLIITADDGSGGPLMSPLSPR PA
0
924-932 (9) SLSSNPSSR PA
1
939-958 (20) DPSPVCGSLRPPIVIHSSGK PA
0
969-998 (30) VYMGDSDVYTVHHVVWSVEDGSPAQEAGLR PA
0
999-1025 (27) AGDLITHINGESVLGLVHMDVVELLLK PA
0
1034-1043 (10) TTALENTSIK PA
0
1082-1090 (9) QTSVLHTSR PA
0
1091-1123 (33) SFSSGLHHSLSSSESLPGSPTHSLSPSPTTPCR PA
0
1124-1167 (44) SPAPDVPADTTASPPSASPSSSSPASPAAAGHTRPSSLHGLAAK PA
0
1180-1200 (21) STSSIPPSPLACPPISAPPPR PA
0
1201-1214 (14) SPSPLPGHPPAPAR PA
0
1243-1252 (10) GPEAELVVMR PA
0
1266-1308 (43) QEAVQEVSFDEPQEEATGLPTSVPQIAVEGEEAVPVALGPTGR PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center