Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O60320-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-8 (8) MPPAGGPR PA
0
9-17 (9) APRPAALPR PA
0
31-61 (31) IVLALGATQMALGCLIVAVSFAALALTTSAR PA
0
64-86 (23) HSCPFWAGFSVLLSGLIGVVSWK PA
0
87-131 (45) RPLSLVITFFMLLSAVCVMLNLAGSILSCQNAQLVNSLEGCQLIK PA
0
132-158 (27) FDSVEVCVCCELQHQSSGCSNLGETLK PA
0
159-170 (12) LNPLQENCNAVR PA
0
175-215 (41) DLLFSVCALNVLSTIVCALATAMCCMQMVSSDVLQMFLPQR PA
0
216-264 (49) SHPANPTCVTPHGTVLHQTLDFDEFIPPLPPPPYYPPEYTCTPSTEAQR PA
1
265-393 (129) GLHLDFAPSPFGTLYDVAINSPGLLYPAELPPPYEAVVGQPPASQVTSIGQQVAESSSGDPNTSAGFSTPVPADSTSLLV
SEGTATPGSSPSPDGPVGAPAPSEPALPPGHVSPEDPGMGSQVQPGPGR PA
1
397-439 (43) STSDPTLCTSSMAGDASSHRPSCSQDLEAGLSEAVPGSASMSR PA
1
447-459 (13) AQLSPAGDPDTWK PA
1
460-474 (15) TDQRPTPEPFPATSK PA
1
496-516 (21) FLEHSHCALPTEAQHMVGAMR PA
1
517-524 (8) LAVTNEER PA
1
525-539 (15) LEEEAVFGADVLDQV PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center