Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O60320-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-19 (19) MCCMQMVSSDVLQMFLPQR PA
0
20-68 (49) SHPANPTCVTPHGTVLHQTLDFDEFIPPLPPPPYYPPEYTCTPSTEAQR PA
1
69-197 (129) GLHLDFAPSPFGTLYDVAINSPGLLYPAELPPPYEAVVGQPPASQVTSIGQQVAESSSGDPNTSAGFSTPVPADSTSLLV
SEGTATPGSSPSPDGPVGAPAPSEPALPPGHVSPEDPGMGSQVQPGPGR PA
1
201-243 (43) STSDPTLCTSSMAGDASSHRPSCSQDLEAGLSEAVPGSASMSR PA
1
251-263 (13) AQLSPAGDPDTWK PA
1
264-278 (15) TDQRPTPEPFPATSK PA
1
300-320 (21) FLEHSHCALPTEAQHMVGAMR PA
1
321-328 (8) LAVTNEER PA
1
329-343 (15) LEEEAVFGADVLDQV PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center