Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O60346-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-11 (11) MEPAAAATVQR PA
0
21-49 (29) ASAPAAAAAAAAAAAAAAAALAAAAGGGR PA
0
50-71 (22) SPEPALTPAAPSGGNGSGSGAR PA
0
72-86 (15) EEAPGEAPPGPLPGR PA
0
97-122 (26) GAPQPIAGGAAPVPGAGGGANSLLLR PA
0
129-170 (42) NLSAAAAAASSSSSSSAAAASHSPGAAGLPASCSASASLCTR PA
0
183-192 (10) QTLQLQPSDR PA
0
202-209 (8) GCVHVFDR PA
0
210-233 (24) HMASTYLRPVLCTLDTTAGEVAAR PA
0
247-258 (12) VLGQGPGAAAAR PA
0
259-270 (12) EPAEPPPEAGPR PA
0
278-285 (8) DSEVPPAR PA
0
286-296 (11) SAPGAFGGPPR PA
0
297-314 (18) APPADLPLPVGGPGGWSR PA
0
316-338 (23) ASPAPSDSSPGEPFVGGPVSSPR PA
0
339-362 (24) APRPVVSDTESFSLSPSAESVSDR PA
0
363-395 (33) LDPYSSGGGSSSSSEELEADAASAPTGVPGQPR PA
0
396-418 (23) RPGHPAQPLPLPQTASSPQPQQK PA
0
422-431 (10) AIDSPGGAVR PA
0
439-454 (16) AAAAVAPGGLQSTPGR PA
0
462-481 (20) APPPPPPPTLYVQLHGETTR PA
0
483-507 (25) LEAEEKPLQIQNDYLFQLGFGELWR PA
0
508-522 (15) VQEEGMDSEIGCLIR PA
0
523-536 (14) FYAGKPHSTGSSER PA
0
537-546 (10) IQLSGMYNVR PA
0
561-575 (15) QVILCGTCLIVSSVK PA
0
582-591 (10) MHVLPLIGGK PA
0
598-626 (29) HQHCLAFSSSGPQSQTYYICFDTFTEYLR PA
0
639-668 (30) ISSVDLSCCSLEHLPANLFYSQDLTHLNLK PA
0
674-682 (9) QNPSLPAAR PA
0
695-727 (33) SLNLSNNHLGDFPLAVCSIPTLAELNVSCNALR PA
0
728-760 (33) SVPAAVGVMHNLQTFLLDGNFLQSLPAELENMK PA
0
761-781 (21) QLSYLGLSFNEFTDIPEVLEK PA
0
788-799 (12) LCMSGNCVETLR PA
0
822-839 (18) LIADEVDFLQHVTQLDLR PA
0
843-861 (19) LGDLDAMIFNNIEVLHCER PA
0
862-875 (14) NQLVTLDICGYFLK PA
0
876-903 (28) ALYASSNELVQLDVYPVPNYLSYMDVSR PA
0
906-917 (12) LENVPEWVCESR PA
0
919-935 (17) LEVLDIGHNQICELPAR PA
0
936-943 (8) LFCNSSLR PA
0
945-954 (10) LLAGHNQLAR PA
0
962-984 (23) TSVEVLDVQHNQLLELPPNLLMK PA
0
990-997 (8) FLNASANK PA
0
998-1027 (30) LESLPPATLSEETNSILQELYLTNNSLTDK PA
0
1028-1039 (12) CVPLLTGHPHLK PA
0
1040-1047 (8) ILHMAYNR PA
0
1048-1055 (8) LQSFPASK PA
0
1059-1071 (13) LEELEEIDLSGNK PA
0
1074-1083 (10) AIPTTIMNCR PA
0
1085-1108 (24) MHTVIAHSNCIEVFPEVMQLPEIK PA
0
1109-1129 (21) CVDLSCNELSEVTLPENLPPK PA
0
1130-1140 (11) LQELDLTGNPR PA
0
1147-1155 (9) TLELLNNIR PA
0
1159-1185 (27) IDQPSTGDASGAPAVWSHGYTEASGVK PA
0
1188-1202 (15) LCVAALSVNNFCDNR PA
0
1203-1213 (11) EALYGVFDGDR PA
0
1214-1235 (22) NVEVPYLLQCTMSDILAEELQK PA
0
1238-1252 (15) NEEEYMVNTFIVMQR PA
0
1261-1271 (11) LGGAAVLCHIK PA
0
1272-1290 (19) HDPVDPGGSFTLTSANVGK PA
0
1298-1306 (9) NGKPLPLSR PA
0
1307-1317 (11) SYIMSCEEELK PA
0
1324-1331 (8) AIITEDGK PA
0
1332-1340 (9) VNGVTESTR PA
0
1341-1374 (34) ILGYTFLHPSVVPRPHVQSVLLTPQDEFFILGSK PA
0
1375-1390 (16) GLWDSLSVEEAVEAVR PA
0
1391-1400 (10) NVPDALAAAK PA
0
1402-1457 (56) LCTLAQSYGCHDSISAVVVQLSVTEDSFCCCELSAGGAVPPPSPGIFPPSVNMVIK PA
0
1458-1515 (58) DRPSDGLGVPSSSSGMASEISSELSTSEMSSEVGSTASDEPPPGALSENSPAYPSEQR PA
0
1516-1529 (14) CMLHPICLSNSFQR PA
0
1530-1562 (33) QLSSATFSSAFSDNGLDSDDEEPIEGVFTNGSR PA
0
1563-1573 (11) VEVEVDIHCSR PA
0
1580-1608 (29) QQHLLQVPAEASDEGIVISANEDEPGLPR PA
0
1610-1620 (11) ADFSAVGTIGR PA
0
1623-1632 (10) ANGSVAPQER PA
0
1633-1646 (14) SHNVIEVATDAPLR PA
0
1647-1675 (29) KPGGYFAAPAQPDPDDQFIIPPELEEEVK PA
0
1680-1702 (23) HHQEQQQQQQPPPPPQLQPQLPR PA
0
1703-1717 (15) HYQLDQLPDYYDTPL PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center