Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O60391-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
6-32 (27) ALWLGLALALGPGSAGGHPQPCGVLAR PA
0
66-82 (17) LPHNLSLELVVAAPPAR PA
0
90-132 (43) GLCQALVPPGVAALLAFPEARPELLQLHFLAAATETPVLSLLR PA
0
137-180 (44) APLGAPNPFHLQLHWASPLETLLDVLVAVLQAHAWEDVGLALCR PA
0
181-194 (14) TQDPGGLVALWTSR PA
0
195-207 (13) AGRPPQLVLDLSR PA
0
209-216 (8) DTGDAGLR PA
0
219-244 (26) LAPMAAPVGGEAPVPAAVLLGCDIAR PA
0
248-267 (20) VLEAVPPGPHWLLGTPLPPK PA
0
268-302 (35) ALPTAGLPPGLLALGEVARPPLEAAIHDIVQLVAR PA
0
303-313 (11) ALGSAAQVQPK PA
0
315-336 (22) ALLPAPVNCGDLQPAGPESPGR PA
0
341-350 (10) FLANTSFQGR PA
0
351-366 (16) TGPVWVTGSSQVHMSR PA
0
379-390 (12) GAPAWATVGSWR PA
0
391-416 (26) DGQLDLEPGGASARPPPPQGAQVWPK PA
0
419-431 (13) VVTLLEHPFVFAR PA
0
432-470 (39) DPDEDGQCPAGQLCLDPGTNDSATLDALFAALANGSAPR PA
0
475-486 (12) CCYGYCIDLLER PA
0
487-504 (18) LAEDTPFDFELYLVGDGK PA
0
513-524 (12) WTGLVGDLLAGR PA
0
525-538 (14) AHMAVTSFSINSAR PA
0
539-558 (20) SQVVDFTSPFFSTSLGIMVR PA
0
561-598 (38) DTASPIGAFMWPLHWSTWLGVFAALHLTALFLTVYEWR PA
0
599-606 (8) SPYGLTPR PA
0
611-629 (19) STVFSYSSALNLCYAILFR PA
0
644-672 (29) LLMNLWAIFCLLVLSSYTANLAAVMVGDK PA
0
673-684 (12) TFEELSGIHDPK PA
0
685-693 (9) LHHPAQGFR PA
0
694-707 (14) FGTVWESSAEAYIK PA
0
709-718 (10) SFPDMHAHMR PA
0
720-727 (8) HSAPTTPR PA
0
728-738 (11) GVAMLTSDPPK PA
0
739-746 (8) LNAFIMDK PA
0
747-760 (14) SLLDYEVSIDADCK PA
0
761-793 (33) LLTVGKPFAIEGYGIGLPQNSPLTSNLSEFISR PA
0
796-806 (11) SSGFIDLLHDK PA
0
817-857 (41) VFAVTETLQMSIYHFAGLFVLLCLGLGSALLSSLGEHAFFR PA
0
869-878 (10) LQYWLHTSQK PA
0
882-892 (11) ALNTEPPEGSK PA
0
893-922 (30) EETAEAEPSGPEVEQQQQQQDQPTAPEGWK PA
0
936-957 (22) FLLEPAVVVAPEADAEAEAAPR PA
0
958-988 (31) EGPVWLCSYGRPPAARPTGAPQPGELQELER PA
0
1005-1016 (12) GQLLAQLGDSAR PA
0
1027-1043 (17) AAPAEAPPHSGRPGSQE PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center