Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O60403-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-53 (53) MLGLNHTSMSEFILVGFSAFPHLQLMLFLLFLLMYLFTLLGNLLIMATVWSER PA
0
54-80 (27) SLHTPMYLFLCVLSVSEILYTVAIIPR PA
0
81-90 (10) MLADLLSTQR PA
2
91-122 (32) SIAFLACASQMFFSFSFGFTHSFLLTVMGYDR PA
2
123-131 (9) YVAICHPLR PA
24
132-139 (8) YNVLMSPR PA
2
140-186 (47) GCACLVGCSWAGGSVMGMVVTSAIFQLTFCGSHEIQHFLCHVPPLLK PA
0
187-228 (42) LACGNNVPAVALGVGLVCIMALLGCFLLILLSYAFIVADILK PA
0
238-264 (27) AFSTCASHLIVVIVHYGFASVIYLKPK PA
0
265-294 (30) GPHSQEGDTLMATTYAVLTPFLSPIIFSLR PA
0
305-315 (11) TFLSTLYSSGT PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center