Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O60412-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
4-80 (77) GNQTEVGNFLLLGFAEDSDMQLLLHGLFLSMYLVTIIGNLLIILTISSDSHLHTPMYFFLSNLSFADICFTSTTVPK PA
0
81-90 (10) MLVNIQTQSK PA
0
91-122 (32) MITFAGCLTQIFFFIAFGCLDNLLLTMTAYDR PA
0
123-139 (17) FVAICYPLHYTVIMNPR PA
0
140-165 (26) LCGLLVLGSWCISVMGSLLETLTILR PA
0
166-186 (21) LSFCTNMEIPHFFCDPSEVLK PA
0
187-227 (41) LACSDTFINNIVMYFVTIVLGVFPLCGILFSYSQIFSSVLR PA
0
236-268 (33) AFSTCGSHLSVVSLFYGTGLGVYLSSAVTPPSR PA
0
269-292 (24) TSLAASVMYTMVTPMLNPFIYSLR PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center