Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O60422-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-29 (29) MELSLESLGGLHSVAHAQAGELLSPGHAR PA
0
37-81 (45) GLVAPGRPGLVAGMASLLDGGGGGGGGGAGGAGGAGSAGGGADFR PA
0
82-123 (42) GELAGPLHPAMGMACEAPGLGGTYTTLTPLQHLPPLAAVADK PA
0
124-159 (36) FHQHAAAAAVAGAHGGHPHAHPHPAAAPPPPPPPQR PA
0
160-172 (13) LAASVSGSFTLMR PA
0
176-190 (15) AALASVGHLYGPYGK PA
0
191-238 (48) ELPAMGSPLSPLPNALPPALHGAPQPPPPPPPPPLAAYGPPGHLAGDK PA
0
239-254 (16) LLPPAAFEPHAALLGR PA
0
262-324 (63) GLPGGGGGTGSGGAGSGSAAGLLAPLGGLAAAGAHGPHGGGGGPGGSGGGPSAGAAAEEINTK PA
0
337-347 (11) YSIPQAIFAQR PA
2
352-361 (10) SQGTLSDLLR PA
2
382-390 (9) WLQEPEFQR PA
2
419-426 (8) LVFTDLQR PA
1
442-466 (25) EMQVTISQQLGLELNTVSNFFMNAR PA
0
473-493 (21) WAEEPSTAPGGPAGATATFSK PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center