Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O60431-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
6-80 (75) QTEISEFFLQGLSEKPEHQTLLFTMFLSTYLVTIIGNALIILAIITDSHLHTPMYFFLFNLSLVDTLLSSTTVPK PA
0
81-90 (10) MLANIQAQSR PA
0
91-122 (32) AIPFVGCLTQMYAFHLFGTMDSFLLAVMAIDR PA
0
123-131 (9) FVAIVHPQR PA
0
132-186 (55) YLVLMCSPVCGLLLGASWMITNLQSLIHTCLMAQLTFCAGSEISHFFCDLMPLLK PA
0
187-220 (34) LSGSDTHTNELVIFAFGIVVGTSPFSCILLSYIR PA
0
237-270 (34) AFSTCGLHLTVVSLSYGTIFAVYLQPTSPSSSQK PA
0
273-293 (21) AAALMCGVFIPMLNPFIYSIR PA
0
308-332 (25) VAVPCPRPEQLLDVYHVPGSLLAAR PA
0
333-352 (20) DTEMHPIPYPGGVQSLAGNR PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center