Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O60443-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
12-30 (19) EVDADGDLIAVSNLNDSDK PA
0
31-39 (9) LQLLSLVTK PA
0
43-50 (8) FWCWQRPK PA
0
51-79 (29) YQFLSLTLGDVLIEDQFPSPVVVESDFVK PA
0
84-98 (15) FANHVSGTLETALGK PA
0
101-108 (8) LNLGGSSR PA
0
109-119 (11) VESQSSFGTLR PA
0
121-130 (10) QEVDLQQLIR PA
0
141-151 (11) NPVLQQVLEGR PA
0
152-161 (10) NEVLCVLTQK PA
0
168-179 (12) CVISEHMQVEEK PA
1
180-189 (10) CGGIVGIQTK PA
1
190-203 (14) TVQVSATEDGNVTK PA
1
204-227 (24) DSNVVLEIPAATTIAYGVIELYVK PA
1
228-238 (11) LDGQFEFCLLR PA
1
250-261 (12) IDSVYLDPLVFR PA
1
262-286 (25) EFAFIDMPDAAHGISSQDGPLSVLK PA
1
287-294 (8) QATLLLER PA
1
295-351 (57) NFHPFAELPEPQQTALSDIFQAVLFDDELLMVLEPVCDDLVSGLSPTVAVLGELKPR PA
1
352-380 (29) QQQDLVAFLQLVGCSLQGGCPGPEDAGSK PA
1
381-409 (29) QLFMTAYFLVSALAEMPDSAAALLGTCCK PA
1
410-421 (12) LQIIPTLCHLLR PA
2
422-440 (19) ALSDDGVSDLEDPTLTPLK PA
2
451-461 (11) LFASADISLER PA
2
476-493 (18) VFPLLLCITLNGLCALGR PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center