Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O60443-3)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
4-15 (12) CVISEHMQVEEK PA
1
16-25 (10) CGGIVGIQTK PA
1
26-39 (14) TVQVSATEDGNVTK PA
1
40-63 (24) DSNVVLEIPAATTIAYGVIELYVK PA
1
64-74 (11) LDGQFEFCLLR PA
1
86-97 (12) IDSVYLDPLVFR PA
1
98-122 (25) EFAFIDMPDAAHGISSQDGPLSVLK PA
1
123-130 (8) QATLLLER PA
1
131-187 (57) NFHPFAELPEPQQTALSDIFQAVLFDDELLMVLEPVCDDLVSGLSPTVAVLGELKPR PA
1
188-216 (29) QQQDLVAFLQLVGCSLQGGCPGPEDAGSK PA
1
217-245 (29) QLFMTAYFLVSALAEMPDSAAALLGTCCK PA
1
246-257 (12) LQIIPTLCHLLR PA
2
258-276 (19) ALSDDGVSDLEDPTLTPLK PA
2
287-297 (11) LFASADISLER PA
2
312-329 (18) VFPLLLCITLNGLCALGR PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center