Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O60499-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-11 (11) MSLEDPFFVVR PA
1
28-40 (13) WCELLQESAAVGR PA
1
41-51 (11) EELDWTTNELR PA
1
56-77 (22) SIEWDLEDLEETIGIVEANPGK PA
0
80-88 (9) LPAGDLQER PA
0
104-117 (14) DHMVSPTAVAFLER PA
0
121-131 (11) EILAGKPAAQK PA
0
132-147 (16) SPSDLLDASAVSATSR PA
1
148-178 (31) YIEEQQATQQLIMDEQDQQLEMVSGSIQVLK PA
1
184-208 (25) VGEELDEQGIMLDAFAQEMDHTQSR PA
1
219-226 (8) VSHMTSDR PA
3
228-249 (22) QWCAIAVLVGVLLLVLILLFSL PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center