Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O60499-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-11 (11) MSLEDPFFVVR PA
1
28-40 (13) WCELLQESAAVGR PA
1
41-51 (11) EELDWTTNELR PA
1
56-82 (27) SIEWDLEDLEETIGIVEANPGKPAAQK PA
0
83-98 (16) SPSDLLDASAVSATSR PA
1
99-129 (31) YIEEQQATQQLIMDEQDQQLEMVSGSIQVLK PA
1
135-159 (25) VGEELDEQGIMLDAFAQEMDHTQSR PA
1
170-177 (8) VSHMTSDR PA
3
179-200 (22) QWCAIAVLVGVLLLVLILLFSL PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center